Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. phaseolicola Large-conductance mechanosensitive channel (mscL)

This Recombinant Pseudomonas syringae pv. phaseolicola Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q48DU1

Expression Region

1-148

Origin

Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPLGLLIGGVDFSDLAIT LRPAQGTAPAVLLAYGKFIQTVIDFIIVAFAIFMGVKAINRLKREEAKAPTLPPTPSKQE VLLSEIRDLLKEQNKPAAPVTVDPTRPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Reactive Protein (CRP) Human ELISA Kit
K069-H1 1 Plate

C-Reactive Protein (CRP) Human ELISA Kit

Sign In for Pricing
View Details
BLVRB (NM_000713) Human Over-expression Lysate
LC400239 20 µg

BLVRB (NM_000713) Human Over-expression Lysate

Sign In for Pricing
View Details
Human POU5F2 activation kit by CRISPRa
GA115217 1 Kit

Human POU5F2 activation kit by CRISPRa

Sign In for Pricing
View Details
SEMA4A (NM_001193302) Human Over-expression Lysate
LY434343 100 µg

SEMA4A (NM_001193302) Human Over-expression Lysate

Sign In for Pricing
View Details
LAMB4 Human Gene Knockout Kit (CRISPR)
KN415486 1 Kit

LAMB4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caspase-6 Recombinant Rabbit Monoclonal Antibody [SC56-09]
ET1610-24 100 µL

Caspase-6 Recombinant Rabbit Monoclonal Antibody [SC56-09]

Sign In for Pricing
View Details