Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Oligosaccharyltransferase complex subunit OSTC (OSTC)

This Recombinant Bovine Oligosaccharyltransferase complex subunit OSTC (OSTC) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

Oligosaccharyltransferase complex subunit OSTC

UniProt

Q2KID7

Expression Region

1-149

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SVTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL
BNC940261-500 1x 500 µL

CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYP1B1 (NM_000104) Human Over-expression Lysate
LY400032 100 µg

CYP1B1 (NM_000104) Human Over-expression Lysate

Sign In for Pricing
View Details
GJA3 Antibody
8C15877-AAT 50 µg

GJA3 Antibody

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-01 20 µg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-02 100 µg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-03 500 µg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details