Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Oligosaccharyltransferase complex subunit OSTC (OSTC)

This Recombinant Bovine Oligosaccharyltransferase complex subunit OSTC (OSTC) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

Oligosaccharyltransferase complex subunit OSTC

UniProt

Q2KID7

Expression Region

1-149

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SVTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcino Embryonic Antigen CEA (CD66e) Antibody
KC-3019-01 50 μL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
KC-3019-02 100 µL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
KC-3019-03 1 mL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
EGFR (GFR1195), CF640R conjugate, 0.1mg/mL
BNC401195-100 1x 100 µL

EGFR (GFR1195), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Formate-1-13C
TRC-S629003-50MG 50 mg

Sodium Formate-1-13C

Sign In for Pricing
View Details
OR5AU1 (NM_001004731) Human Over-expression Lysate
LY423914 100 µg

OR5AU1 (NM_001004731) Human Over-expression Lysate

Sign In for Pricing
View Details