Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitric oxide reductase subunit C (norC)

This Recombinant Nitric oxide reductase subunit C (norC) spans the amino acid sequence from region 2-150.

Product Specifications

Product Name Alternative

Nitric oxide reductase subunit C, NOR small subunit, Nitric oxide reductase cytochrome c subunit

UniProt

Q51662

Expression Region

2-150

Origin

Paracoccus denitrificans

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEIMTKNMARNVFYGGSIFFILIFGALTVHSHIYARTKAVDESQLTPSVVEGKHIWERNA CIDCHTLLGEGAYFAPELGNVMKRWGVQDDPDSAFETLKGWMESMPTGIEGRRQMPRFDL TDEEFRALSDFLLWTGTINTQNWPPNDAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody
HA723871 100 µL

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), 1mg/mL
BNUM0178-50 1x 50 µL

CD50 (ICAM-3) (186-2G9), 1mg/mL

Sign In for Pricing
View Details
1200002N14Rik (BC021433) Mouse Tagged ORF Clone
MG200764 10 µg

1200002N14Rik (BC021433) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rfx7 Mouse Gene Knockout Kit (CRISPR)
KN514711 1 Kit

Rfx7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nogo A (RTN4) (NM_207520) Human Over-expression Lysate
LY403920 100 µg

Nogo A (RTN4) (NM_207520) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-2-Benzyl-3-hydroxypropionic Acid
TRC-B279010-1G 1 g

(R)-2-Benzyl-3-hydroxypropionic Acid

Sign In for Pricing
View Details