Recombinant Uncharacterized protein M6_Spy0510 (M6_Spy0510)
This Recombinant Uncharacterized protein M6_Spy0510 (M6_Spy0510) spans the amino acid sequence from region 1-149.
Product Specifications
Product Name Alternative
Uncharacterized protein M6_Spy0510
UniProt
Q5XD68
Expression Region
1-149
Origin
Streptococcus pyogenes serotype M6
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEKKEKSMNKSFKNLVIGAVSGVAAAYFLSTEKGKALKNRAEKAYQAYKESPDDYHQFAK EKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQKTKETFAEVEAKEKQD DVIIDLNEDDIIIDYTEQDEPVSDTLDKH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6424497-01 0.1 mL
LCK, Phosphorylated (Y505) (Lymphocyte-specific Tyrosine Kinase, LSK, YT16, p56lck, pp58lck) (FITC)
Sign In for Pricing
View Details MBS6424497-02 5x 0.1 mL
LCK, Phosphorylated (Y505) (Lymphocyte-specific Tyrosine Kinase, LSK, YT16, p56lck, pp58lck) (FITC)
Sign In for Pricing
View Details 
M05349-carrier-free 100 µL
Anti-KMT5A / SETD8 / Pr-SET7 Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details