Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Oligosaccharyltransferase complex subunit OSTC (OSTC)

This Recombinant Chicken Oligosaccharyltransferase complex subunit OSTC (OSTC) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

Oligosaccharyltransferase complex subunit OSTC

UniProt

Q5ZJR3

Expression Region

1-149

Origin

Gallus gallus (Chicken)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METLFRLPFAVLECPNIKLKRPGWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac cis-3-Hydroxy Apatinib Dihydrochloride
TRC-H802100-5MG 5 mg

rac cis-3-Hydroxy Apatinib Dihydrochloride

Sign In for Pricing
View Details
2-Isopropylimidazole
TRC-I824715-10G 10 g

2-Isopropylimidazole

Sign In for Pricing
View Details
Human DAO (Diamine Oxidase) CLIA Kit
E-CL-H0805-01 24 Tests

Human DAO (Diamine Oxidase) CLIA Kit

Sign In for Pricing
View Details
Human DAO (Diamine Oxidase) CLIA Kit
E-CL-H0805-02 48 Tests

Human DAO (Diamine Oxidase) CLIA Kit

Sign In for Pricing
View Details
Human DAO (Diamine Oxidase) CLIA Kit
E-CL-H0805-03 96 Tests

Human DAO (Diamine Oxidase) CLIA Kit

Sign In for Pricing
View Details
Human FHOD1 activation kit by CRISPRa
GA109242 1 Kit

Human FHOD1 activation kit by CRISPRa

Sign In for Pricing
View Details