Recombinant Danio rerio Oligosaccharyltransferase complex subunit ostc (ostc)
This Recombinant Danio rerio Oligosaccharyltransferase complex subunit ostc (ostc) spans the amino acid sequence from region 1-149.
Product Specifications
Product Name Alternative
Oligosaccharyltransferase complex subunit ostc
UniProt
Q7ZWJ3
Expression Region
1-149
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
METLFSLPFTVLECPNVKLKKPSWLHMPSAMTVYAVVIVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680195-500 1x 500 µL
CD66 (CEA) (C66/195), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681931-500 1x 500 µL
CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1662-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details