Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oligosaccharyltransferase complex subunit OSTC (OSTC)

This Recombinant Human Oligosaccharyltransferase complex subunit OSTC (OSTC) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

Oligosaccharyltransferase complex subunit OSTC, Hydrophobic protein HSF-28

UniProt

Q9NRP0

Expression Region

1-149

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMIP Human Over-expression Lysate
orb1371530 20 µg

CMIP Human Over-expression Lysate

Sign In for Pricing
View Details
Abi2-set siRNA/shRNA/RNAi Lentivector (Rat)
11104096 4x 500 ng

Abi2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Monoclonal Anti-human C-Peptide antibody
TBS10001-1MG 1 mg

Monoclonal Anti-human C-Peptide antibody

Sign In for Pricing
View Details
Human TNFR2 Protein, His-Avi Tag (Biotin)
orb669285-01 25 µg

Human TNFR2 Protein, His-Avi Tag (Biotin)

Sign In for Pricing
View Details
Human TNFR2 Protein, His-Avi Tag (Biotin)
orb669285-02 200 µg

Human TNFR2 Protein, His-Avi Tag (Biotin)

Sign In for Pricing
View Details
Human beta Nerve growth factor (β-NGF) ELISA Kit
EIA06798h 1 Kit

Human beta Nerve growth factor (β-NGF) ELISA Kit

Sign In for Pricing
View Details