Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel (mscL)

This Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-150.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q0AWD5

Expression Region

1-150

Origin

Syntrophomonas wolfei subsp. wolfei (strain Goettingen)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKEFREFAMRGNVIDLAIGIIIGAAFGKIVTSFVNDILMPPIGLLLGKVDFTNLYINLS GKNYSSLADATAAGAPVIKYGVFLNSIIDFIIVAVAIFLVVKQINRLKKQEVAAAPTTKE CRYCKSEISIAATRCPFCTSELLDTGRPLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-500 1x 500 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF640R conjugate, 0.1mg/mL
BNC401148-500 1x 500 µL

CD45RA (PTPRC/1148), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details