Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel (mscL)
This Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-150.
Product Specifications
Product Name Alternative
Large-conductance mechanosensitive channel
UniProt
Q0AWD5
Expression Region
1-150
Origin
Syntrophomonas wolfei subsp. wolfei (strain Goettingen)
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MWKEFREFAMRGNVIDLAIGIIIGAAFGKIVTSFVNDILMPPIGLLLGKVDFTNLYINLS GKNYSSLADATAAGAPVIKYGVFLNSIIDFIIVAVAIFLVVKQINRLKKQEVAAAPTTKE CRYCKSEISIAATRCPFCTSELLDTGRPLK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15285879 1 Vial
Lentiviral mouse Ubald1 shRNA (UAS) - Lentiviral mouse Ubald1 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details EP22568 96 Tests
Porcine H-FABP (Heart-type Fatty Acid Binding Protein) ELISA Kit
Sign In for Pricing
View Details 
