Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2
This Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2 spans the amino acid sequence from region 1-150.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein type 2 member 2, Chlorophyll a-b binding protein type II 2, CAB, LHCP
UniProt
P15192
Expression Region
1-150
Origin
Pinus sylvestris (Scots pine)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYR VGGGPLGEGLDPLYPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTG KGPIENLYDHLADPVANNAWAYATNFVPGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940977-100 1x 100 µL
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details