Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi B UPF0208 membrane protein YfbV (yfbV)

This Recombinant Salmonella paratyphi B UPF0208 membrane protein YfbV (yfbV) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

UPF0208 membrane protein YfbV

UniProt

A9N4B4

Expression Region

1-151

Origin

Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF488A conjugate, 0.1mg/mL
BNC882309-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details