Recombinant Xenopus laevis FUN14 domain-containing protein 1A (fundc1-a)
This Recombinant Xenopus laevis FUN14 domain-containing protein 1A (fundc1-a) spans the amino acid sequence from region 1-151.
Product Specifications
Product Name Alternative
FUN14 domain-containing protein 1A
UniProt
Q58EA0
Expression Region
1-151
Origin
Xenopus laevis (African clawed frog)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAARREPSSDDESYEVLDLTDYARRHHWWNRLFGRNSGPLTEKYSVATQIVIGGVSGWCA GFLFQKVGKLAATAVGGGFLLLQIASHGGYIQVDWKRVEKDVNNAKRKIKKEANKSAPEI NTLIEESTDFVKKNIVVSGGFVGGFLLGLAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-100 1x 100 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
