Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)
This Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV) spans the amino acid sequence from region 1-151.
Product Specifications
Product Name Alternative
UPF0208 membrane protein YfbV
UniProt
Q5PN46
Expression Region
1-151
Origin
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400460-100 1x 100 µL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882408-100 1x 100 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942227-500 1x 500 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 