Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q7V5S4

Expression Region

1-151

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLLLFGAGGLFDFDATLPLMALQVVLLTFILNALFFRPVGRVVEEREVYVTTSRAEAK QKLAEAEKLELELKEQLKSARIAAQQLIQEAEKDSEQLYREALAIANADANAAREKARRE IDAQRDSALSQLKGDAEKLGDLIVNRLLAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)
MBS7015112-01 0.02 mg

Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)
MBS7015112-02 0.1 mg

Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)
MBS7015112-03 5x 0.1 mg

Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)

Sign In for Pricing
View Details
GPR52 Protein Vector (Human) (pPM-C-HA)
PV018499 500 ng

GPR52 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis HTH-type transcriptional repressor dasR (dasR)
MBS1371837-01 0.02 mg (E-Coli)

Recombinant Streptomyces avermitilis HTH-type transcriptional repressor dasR (dasR)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis HTH-type transcriptional repressor dasR (dasR)
MBS1371837-02 0.1 mg (E-Coli)

Recombinant Streptomyces avermitilis HTH-type transcriptional repressor dasR (dasR)

Sign In for Pricing
View Details