Recombinant Arabidopsis thaliana Copper transporter 3 (COPT3)
This Recombinant Arabidopsis thaliana Copper transporter 3 (COPT3) spans the amino acid sequence from region 1-151.
Product Specifications
Product Name Alternative
Copper transporter 3, AtCOPT3
UniProt
Q9FGU8
Expression Region
1-151
Origin
Arabidopsis thaliana (Mouse-ear cress)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNGMSGSSPAAPAPSPSSFFQHRHRHGGMMHMTFFWGKTTEVLFDGWPGTSLKMYWVCLA VIFVISAFSECLSRCGFMKSGPASLGGGLLQTAVYTVRAALSYLVMLAVMSFNGGVFVAA MAGFGLGFMIFGSRAFRATSSNSHTEVQSHC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471081-100 1x 100 µL
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400050-500 1x 500 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681969-100 1x 100 µL
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680873-500 1x 500 µL
P34 / cdk1 (CDK1/873), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details