Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfur-rich protein, serovar E (srp)

This Recombinant Sulfur-rich protein, serovar E (srp) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

Sulfur-rich protein, serovar E, 15 kDa cysteine-rich outer membrane protein, Cysteine-rich protein A

UniProt

P26757

Expression Region

1-151

Origin

Chlamydia trachomatis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTVPVVQGAGSSNSAQDISTSSAPLTLKERISNLLSSTAFKVGLVVIGLLLVITALIFL VSAASFVNAIYLGIPAILGCVNICVGILSIEGHCSPERWILCKKVLKTSEDIIDDGQINN SNKVFTDERLNAMDGVVESLSRRNSLVDQTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1A siRNA (Human)
MBS8213053-01 15 nmol

POLR1A siRNA (Human)

Sign In for Pricing
View Details
POLR1A siRNA (Human)
MBS8213053-02 30 nmol

POLR1A siRNA (Human)

Sign In for Pricing
View Details
POLR1A siRNA (Human)
MBS8213053-03 5x 30 nmol

POLR1A siRNA (Human)

Sign In for Pricing
View Details
RealStar®VZV PCR Kit 1.0 RUO
071003 96 Tests

RealStar®VZV PCR Kit 1.0 RUO

Sign In for Pricing
View Details
Annexin A1 Blocking Peptide
CBP4563-01 1 mg

Annexin A1 Blocking Peptide

Sign In for Pricing
View Details
Annexin A1 Blocking Peptide
CBP4563-02 5 mg

Annexin A1 Blocking Peptide

Sign In for Pricing
View Details