Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxaI (yxaI)

This Recombinant Bacillus subtilis Uncharacterized protein yxaI (yxaI) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

Uncharacterized protein yxaI

UniProt

P42108

Expression Region

1-151

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKPAGFWIRFLAYFIDGIIVSVPSYIILFIINSVFVAGAVATNPYMTEEEYLVKYMTLA FLPTMLIMIVISVLYYGLLTASKMQGTLGKKILGLKVVNEQGERVSVGQGIGRYFAYILS GIIFYIGFIMIAFGEKKGLHDIICKTRVVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E (NM_001968) Human Recombinant Protein
TP307333M 100 µg

EIF4E (NM_001968) Human Recombinant Protein

Sign In for Pricing
View Details
S100P Antibody
KC-1539-01 50 μL

S100P Antibody

Sign In for Pricing
View Details
S100P Antibody
KC-1539-02 100 µL

S100P Antibody

Sign In for Pricing
View Details
S100P Antibody
KC-1539-03 1 mL

S100P Antibody

Sign In for Pricing
View Details
Amidosulfonic Acid-15N
TRC-A576786-5MG 5 mg

Amidosulfonic Acid-15N

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS702889 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details