Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yckC (yckC)

This Recombinant Bacillus subtilis Uncharacterized protein yckC (yckC) spans the amino acid sequence from region 1-151.

Product Specifications

Product Name Alternative

Uncharacterized protein yckC, ORF3

UniProt

P42401

Expression Region

1-151

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPMFW RGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGLGLIASLILIAVREDKR TLHDLIAGTYVTYATPGEEELNADEEIRKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glycolipid Autoantibody ELISA Kit
MBS038660-01 48 Well

Human Glycolipid Autoantibody ELISA Kit

Sign In for Pricing
View Details
Human Glycolipid Autoantibody ELISA Kit
MBS038660-02 96 Well

Human Glycolipid Autoantibody ELISA Kit

Sign In for Pricing
View Details
Human Glycolipid Autoantibody ELISA Kit
MBS038660-03 5x 96 Well

Human Glycolipid Autoantibody ELISA Kit

Sign In for Pricing
View Details
Human Glycolipid Autoantibody ELISA Kit
MBS038660-04 10x 96 Well

Human Glycolipid Autoantibody ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RUNX1 Protein, N-His-SUMO
orb2963255-01 50 µg

Recombinant Human RUNX1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human RUNX1 Protein, N-His-SUMO
orb2963255-02 100 µg

Recombinant Human RUNX1 Protein, N-His-SUMO

Sign In for Pricing
View Details