Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ybbJ (ybbJ)

This Recombinant Inner membrane protein ybbJ (ybbJ) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Inner membrane protein ybbJ

UniProt

P0AAS4

Expression Region

1-152

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS WPVSASEDLGAGTHVEVIAIEGITLHIRAVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sdhaf3 Mouse Gene Knockout Kit (CRISPR)
KN500722 1 Kit

Sdhaf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arhgef16 Rabbit Polyclonal Antibody
TA363334 100 µL

Arhgef16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyanoacetic Acid-13C2
TRC-C987482-500MG 500 mg

Cyanoacetic Acid-13C2

Sign In for Pricing
View Details
TMEM169 (NM_001142310) Human Recombinant Protein
TP327010M 100 µg

TMEM169 (NM_001142310) Human Recombinant Protein

Sign In for Pricing
View Details
Human GARNL3 activation kit by CRISPRa
GA113451 1 Kit

Human GARNL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethanol-d6
TRC-E890124-1G 1 g

Ethanol-d6

Sign In for Pricing
View Details