Recombinant Citrobacter koseri UPF0266 membrane protein CKO_01158 (CKO_01158)
This Recombinant Citrobacter koseri UPF0266 membrane protein CKO_01158 (CKO_01158) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
UPF0266 membrane protein CKO_01158
UniProt
A8AFN6
Expression Region
1-152
Origin
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTVTDLVLVLFIVALLAYAIYDQFIMPRRNGPTLLAVPLLRRGRVDSVIFVGLVAILIYN NVTSHGAQITTWLLCALALMGFYIFWVRAPRIIFKQKGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLERIYKLLVSSQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680994-100 1x 100 µL
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680010-500 1x 500 µL
MART-1 / Melan-A (M2-9E3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details