Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A UPF0266 membrane protein yobD (yobD)

This Recombinant Salmonella paratyphi A UPF0266 membrane protein yobD (yobD) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

UPF0266 membrane protein yobD

UniProt

B5BHC3

Expression Region

1-152

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTITDLVLILFIAALLVYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVHNIDDLEKIYKLLIENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-100 1x 100 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-500 1x 500 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details