Recombinant Pichia pastoris Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)
This Recombinant Pichia pastoris Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
C4QV79
Expression Region
1-152
Origin
Pichia pastoris (strain GS115 / ATCC 20864) (Yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASVNYPSSFDKKDEFEDMSILDKIWFRCKQQPLVPIGCLATCVAVALAAKGVRTGDRVN AQKWFRWRVGLQGLTLVALVGGSYIYDRQQVTQRKTDEDLAREKAQHRQDLWIQELERRD QETKRNKERARLARARLEAERSTGILDDEPPK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
