Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yfjE (yfjE)

This Recombinant Bacillus subtilis Uncharacterized protein yfjE (yfjE) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Uncharacterized protein yfjE

UniProt

O31554

Expression Region

1-152

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEALTFESKYALLYLGGGLLAMIYGLITFFMAFPAFTSRGNVIFTIKTGPSGEIFLRKR SVLFSEVKRLYMGRHQYSLKGIFFEDIIIEKTDGKIVRIPTWNIITNPLFFEAVERYILP HLNEEAQNNWISQFTEVQRKAYLKEFENHPKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Napsin-A (NAPSA/1239), 0.2mg/mL
BNUB1239-100 1x 100 µL

Napsin-A (NAPSA/1239), 0.2mg/mL

Sign In for Pricing
View Details
Histiocytoma Marker (D11), CF594 conjugate, 0.1mg/mL
BNC940348-100 1x 100 µL

Histiocytoma Marker (D11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS801570 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
MRPL12 Antibody
8C14056-AAT 50 µg

MRPL12 Antibody

Sign In for Pricing
View Details
CD6 (3F7B5), CF568 conjugate, 0.1mg/mL
BNC680428-500 1x 500 µL

CD6 (3F7B5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EP300 Rabbit Polyclonal Antibody
AP20224PU-N 100 µg

EP300 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details