Recombinant Danio rerio Transmembrane protein 18 (tmem18)
This Recombinant Danio rerio Transmembrane protein 18 (tmem18) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
Transmembrane protein 18
UniProt
Q641M3
Expression Region
1-152
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTASNTKNASAIPIDKFSNVRITSIWTFLQSVDWSEPWLMALLAFHVFCFAFTLLSCKYY RIQICHFLLMVAMVYSAEYLNELAAMNWRSFSKFQYFDSKGMFISLVYSVPLLLNTVIIV AVWVWRTFSTMTELKILQLKRKAARENHKKTQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400419-100 1x 100 µL
Transglutaminase II (TGM2/419), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471790-500 1x 500 µL
CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400461-500 1x 500 µL
Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400859-500 1x 500 µL
Human Kappa Light Chain (Kap-56), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details