Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chemokine-like factor (CKLF)

This Recombinant Human Chemokine-like factor (CKLF) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Chemokine-like factor, C32

UniProt

Q9UBR5

Expression Region

1-152

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFI LLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVC CLADGALIYRKLLFNPSGPYQKKPVHEKKEVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADAMTS17 activation kit by CRISPRa
GA116223 1 Kit

Human ADAMTS17 activation kit by CRISPRa

Sign In for Pricing
View Details
Dmac2l Mouse Gene Knockout Kit (CRISPR)
KN501802 1 Kit

Dmac2l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GNRPX (PLEKHJ1) activation kit by CRISPRa
GA110523 1 Kit

Human GNRPX (PLEKHJ1) activation kit by CRISPRa

Sign In for Pricing
View Details
Ion Exchange Resin
EC-408 100 g

Ion Exchange Resin

Sign In for Pricing
View Details
4-(Benzyloxy)butanoic Acid
TRC-B291563-250MG 250 mg

4-(Benzyloxy)butanoic Acid

Sign In for Pricing
View Details
FAM122A (NM_138333) Human Recombinant Protein
TP303857M 100 µg

FAM122A (NM_138333) Human Recombinant Protein

Sign In for Pricing
View Details