Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chemokine-like factor (CKLF)

This Recombinant Human Chemokine-like factor (CKLF) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Chemokine-like factor, C32

UniProt

Q9UBR5

Expression Region

1-152

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFI LLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVC CLADGALIYRKLLFNPSGPYQKKPVHEKKEVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG3 Polyclonal Antibody
E-AB-10813-01 20 µL

ATG3 Polyclonal Antibody

Sign In for Pricing
View Details
ATG3 Polyclonal Antibody
E-AB-10813-02 60 µL

ATG3 Polyclonal Antibody

Sign In for Pricing
View Details
ATG3 Polyclonal Antibody
E-AB-10813-03 120 µL

ATG3 Polyclonal Antibody

Sign In for Pricing
View Details
ATG3 Polyclonal Antibody
E-AB-10813-04 200 µL

ATG3 Polyclonal Antibody

Sign In for Pricing
View Details
Stearoyl Ethanolamide
TRC-S686608-1G 1 g

Stearoyl Ethanolamide

Sign In for Pricing
View Details
SERTAD4 (C-term) Rabbit Polyclonal Antibody
AP53866PU-N 400 µL

SERTAD4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details