Recombinant Synechococcus sp. Photosystem I reaction center subunit XI (psaL)
This Recombinant Synechococcus sp. Photosystem I reaction center subunit XI (psaL) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
Photosystem I reaction center subunit XI, PSI subunit V, PSI-L
UniProt
Q54753
Expression Region
1-152
Origin
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDIIQHGGDPQVGNLATPINASAFSKAFINNLPGYRQGLSAQRRGLEVGMAHGYFLYGPF ALLGPLRNADFAGVAGLLGTVGLISLLTLALSLYGSVGVSTPTATLTTPNPPENLGTKEG WSEFAAGFLIGGCGGALVAYGLCIALPMMYTI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740525-500 1x 500 µL
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402337-500 1x 500 µL
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682036-500 1x 500 µL
Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741859-500 1x 500 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details