Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L153 (MIMI_L153)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L153 (MIMI_L153) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Uncharacterized protein L153

UniProt

Q5UPL7

Expression Region

1-152

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNSMILLMVIASFVAGYLSTMNLWANSIGDIRLHLNDFYMVLLMVGWMIVMCYILMKSH MGITKTQLIITITIIIIIVYAIRTQAFIDDKQYLNGMIPHHSMAITMSKWIVNRTKDPRI KQLATDIIISQQNEINEMNSILDERKLQNKVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cresyl Diphenyl Phosphate-d7 Isomer 1
TRC-C783016-50MG 50 mg

Cresyl Diphenyl Phosphate-d7 Isomer 1

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF740 conjugate, 0.1mg/mL
BNC740282-100 1x 100 µL

HER-2 / CD340 (HRB2/282), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3-Dehydro-3,4-dihydro Moxidectin
TRC-D293860-2.5MG 2.5 mg

2,3-Dehydro-3,4-dihydro Moxidectin

Sign In for Pricing
View Details
PIK3IP1 (NM_001135911) Human Over-expression Lysate
LY427727 100 µg

PIK3IP1 (NM_001135911) Human Over-expression Lysate

Sign In for Pricing
View Details
NRF1 (NRF1/2608), Biotin conjugate, 0.1mg/mL
BNCB2608-500 1x 500 µL

NRF1 (NRF1/2608), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ang (NM_007447) Mouse Tagged ORF Clone
MG200967 10 µg

Ang (NM_007447) Mouse Tagged ORF Clone

Sign In for Pricing
View Details