Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L153 (MIMI_L153)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L153 (MIMI_L153) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Uncharacterized protein L153

UniProt

Q5UPL7

Expression Region

1-152

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNSMILLMVIASFVAGYLSTMNLWANSIGDIRLHLNDFYMVLLMVGWMIVMCYILMKSH MGITKTQLIITITIIIIIVYAIRTQAFIDDKQYLNGMIPHHSMAITMSKWIVNRTKDPRI KQLATDIIISQQNEINEMNSILDERKLQNKVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Licofelone
TRC-L397730-1MG 1 mg

Licofelone

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF488A conjugate, 0.1mg/mL
BNC880763-100 1x 100 µL

CD34 (HPCA1/763), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTMR4 Polyclonal Antibody
E-AB-67910-01 60 µL

MTMR4 Polyclonal Antibody

Sign In for Pricing
View Details
MTMR4 Polyclonal Antibody
E-AB-67910-02 120 µL

MTMR4 Polyclonal Antibody

Sign In for Pricing
View Details
MTMR4 Polyclonal Antibody
E-AB-67910-03 200 µL

MTMR4 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL40 Human Gene Knockout Kit (CRISPR)
KN402166 1 Kit

MRPL40 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details