Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella haemolytica Biopolymer transport protein exbB (exbB)

This Recombinant Pasteurella haemolytica Biopolymer transport protein exbB (exbB) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Biopolymer transport protein exbB

UniProt

P72202

Expression Region

1-152

Origin

Pasteurella haemolytica (Mannheimia haemolytica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQLFQFLEHHTDFVILGLLGLLSVICLWKAIERIMFYSKVDISKYDTLEELDIDLTHNL TTISTIGSNAPYIGLLGTVVGILLTFYHLGQSGGDIDAASIMVNLSLALKATAVGILVAI IAMVFYNGFGRKVEENKLKWLALQSKKPHQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF594 conjugate, 0.1mg/mL
BNC941953-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL
BNC680919-100 1x 100 µL

CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF405S conjugate, 0.1mg/mL
BNC042103-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details