Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A2BYH9

Expression Region

1-153

Origin

Prochlorococcus marinus (strain MIT 9515)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGKVVEKREKFVSNNIME AKNKLSEVEKLEADLLSQLQSARSEAQKIVSDAENESDKLYKEALELANNEANASKEKAR LEIENQTSSARDQLFKQADDLSELIVNRLILEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TSC2 Antibody [DyLight 594]
NBP1-76619DL594 0.1 mL

Rabbit Polyclonal TSC2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Olr3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7250705 3x 1.0 µg

Olr3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Chic1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3139303 1.0 µg DNA

Chic1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Influ, A H2N2 (Mallard/New York/6750/1978) Hemaggl., His-SUMO, E.coli-200ug
QP7702-ec-200ug 200ug

Recombinant Influ, A H2N2 (Mallard/New York/6750/1978) Hemaggl., His-SUMO, E.coli-200ug

Sign In for Pricing
View Details
Apolipoprotein A4 (APOA4) Antibody
abx010414 100 µL

Apolipoprotein A4 (APOA4) Antibody

Sign In for Pricing
View Details
Human Arachidonic Acid (AA) Elisa Kit
EK700335 96 Well

Human Arachidonic Acid (AA) Elisa Kit

Sign In for Pricing
View Details