Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A2BYH9

Expression Region

1-153

Origin

Prochlorococcus marinus (strain MIT 9515)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGKVVEKREKFVSNNIME AKNKLSEVEKLEADLLSQLQSARSEAQKIVSDAENESDKLYKEALELANNEANASKEKAR LEIENQTSSARDQLFKQADDLSELIVNRLILEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-2-fluoro-6-iodoaniline
PC56999-01 250 mg

3-Bromo-2-fluoro-6-iodoaniline

Sign In for Pricing
View Details
3-Bromo-2-fluoro-6-iodoaniline
PC56999-02 1 g

3-Bromo-2-fluoro-6-iodoaniline

Sign In for Pricing
View Details
CD133 (A8N6N) Mouse Monoclonal Antibody (Alexa Fluor® 488 Conjugate)
CST 38725S 100 µL

CD133 (A8N6N) Mouse Monoclonal Antibody (Alexa Fluor® 488 Conjugate)

Sign In for Pricing
View Details
Anti-CDH3 antibody (6A10) ; IgG1 Chimeric mAb
12-9503-100 100 µg

Anti-CDH3 antibody (6A10) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details
Recombinant Human CD3D (C-6His)
PHH1987-01 10 µg

Recombinant Human CD3D (C-6His)

Sign In for Pricing
View Details
Recombinant Human CD3D (C-6His)
PHH1987-02 50 µg

Recombinant Human CD3D (C-6His)

Sign In for Pricing
View Details