Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A3PEU2

Expression Region

1-153

Origin

Prochlorococcus marinus (strain MIT 9301)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKREKFVSNNVIE AKNKLSEVKKLEADLLTQLQSARTEAQRIVSEAEDESDKLYKEALELANNEANASKEKAR LEIESQTSAARDQLSKQADVLSELIVNRLILEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP7 Antibody
CSB-PA439452-01 50 μL

IGFBP7 Antibody

Sign In for Pricing
View Details
IGFBP7 Antibody
CSB-PA439452-02 100 µL

IGFBP7 Antibody

Sign In for Pricing
View Details
SR144528
MBS5755553 Inquire

SR144528

Sign In for Pricing
View Details
Anti-CDK5 Antibody Picoband®, PE Conjugate
A00511-1-PE 100 µg/Vial

Anti-CDK5 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
ZN414 rabbit pAb
E44H15935 100 µL

ZN414 rabbit pAb

Sign In for Pricing
View Details
B3GALNT1 (NM_003781) Human Tagged Lenti ORF Clone
RC224542L4 10 µg

B3GALNT1 (NM_003781) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details