Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ykuH (ykuH)

This Recombinant Bacillus subtilis Uncharacterized protein ykuH (ykuH) spans the amino acid sequence from region 30-182.

Product Specifications

Product Name Alternative

Uncharacterized protein ykuH

UniProt

O31696

Expression Region

30-182

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FSPEYYQNTNLTSNEIIRFEKLYHIDFPDETKFIKAREYLAGPGGDTSAVLYVSLPTKRV EKVLSDYTYMKINYTDNVGSMYGVDVSKSVAGLTTLTFGTYDKKGTFYNMKHDDDWMYKG TDWNLYFWTAASYNAVIFVFVLVIVKQMNKILN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL3 Antibody
8C11840-AAT 50 µg

KLHL3 Antibody

Sign In for Pricing
View Details
Cnih2 Mouse Gene Knockout Kit (CRISPR)
KN503544 1 Kit

Cnih2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF640R conjugate, 0.1mg/mL
BNC402651-100 1x 100 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Garnet shards, bulk, acid washed, 250g bottle
D1133-G 1 Each

Garnet shards, bulk, acid washed, 250g bottle

Sign In for Pricing
View Details
LIN37 Rabbit Polyclonal Antibody
TA369674 100 µL

LIN37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant SUN2 Antibody
RC-16730-01 50 μL

Recombinant SUN2 Antibody

Sign In for Pricing
View Details