Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0266 membrane protein YPK_2467 (YPK_2467)
This Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0266 membrane protein YPK_2467 (YPK_2467) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
UPF0266 membrane protein YPK_2467
UniProt
B1JP58
Expression Region
1-153
Origin
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940050-500 1x 500 µL
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681959-100 1x 100 µL
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041999-100 1x 100 µL
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740096-100 1x 100 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details