Recombinant Bovine ORM1-like protein 1 (ORMDL1)
This Recombinant Bovine ORM1-like protein 1 (ORMDL1) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
ORM1-like protein 1
UniProt
Q29RQ9
Expression Region
1-153
Origin
Bos taurus (Bovine)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNVIHNLGM YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD TTHFILNTASLLSVLIPKMPQLHGVRIFGINKY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E8257 96 Tests
Major facilitator superfamily domain-containing protein 6 (MFSD6) Mouse ELISA Kit
Sign In for Pricing
View Details 
042760-APC 200 µL
TFAP4, ID (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (APC) discontinued
Sign In for Pricing
View Details 