Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q318T8

Expression Region

1-153

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKREKFVSNNIIE AKNKLSEVKKLEAELLTQLQSARTEAQRIVGEAENESDKLYKEALELANNEANASKEKAR LEIESQTSAARDQLSKQADDLSELIVNRLILEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RYR1 (Ryanodine receptor 1) ELISA Kit
EH1599 96 Tests

Human RYR1 (Ryanodine receptor 1) ELISA Kit

Sign In for Pricing
View Details
Canine GMP-140 ELISA Kit
ECG0345 96 Tests

Canine GMP-140 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SPAG9 Protein - (Dry Ice)
H00009043-P01-10ug 10 µg

Recombinant Human SPAG9 Protein - (Dry Ice)

Sign In for Pricing
View Details
RPS24 (NM_033022) Human Recombinant Protein
PH37411M5 20 µg

RPS24 (NM_033022) Human Recombinant Protein

Sign In for Pricing
View Details
Polyclonal GPR137B Antibody (Cytoplasmic Domain)
APR16493G 0.05mg

Polyclonal GPR137B Antibody (Cytoplasmic Domain)

Sign In for Pricing
View Details
Bovine Cysteine Rich Secretory Protein 3 ELISA Kit
MBS065084-01 48 Well

Bovine Cysteine Rich Secretory Protein 3 ELISA Kit

Sign In for Pricing
View Details