Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q318T8

Expression Region

1-153

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFNFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKREKFVSNNIIE AKNKLSEVKKLEAELLTQLQSARTEAQRIVGEAENESDKLYKEALELANNEANASKEKAR LEIESQTSAARDQLSKQADDLSELIVNRLILEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epn2 (NM_001252189) Mouse Tagged ORF Clone
MR230588 10 µg

Epn2 (NM_001252189) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
5 (6) -FAM SE 5mg
A21295-5 5 mg

5 (6) -FAM SE 5mg

Sign In for Pricing
View Details
Usp1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4758104 1.0 µg DNA

Usp1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Ran-Binding Protein 1 (RANBP1) Antibody
abx218174-01 50 µg

Ran-Binding Protein 1 (RANBP1) Antibody

Sign In for Pricing
View Details
Ran-Binding Protein 1 (RANBP1) Antibody
abx218174-02 100 µg

Ran-Binding Protein 1 (RANBP1) Antibody

Sign In for Pricing
View Details
EpCAM (Ep-CAM, CD326, Epithelial Cell Adhesion Molecule, Epithelial Specific Antigen, SCLC-CD2 epithelial antigen, EGP-2 , Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, KS 1/4 antigen, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1) discontinued
138544-01 100 µL

EpCAM (Ep-CAM, CD326, Epithelial Cell Adhesion Molecule, Epithelial Specific Antigen, SCLC-CD2 epithelial antigen, EGP-2 , Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, KS 1/4 antigen, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1) discontinued

Sign In for Pricing
View Details