Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ORM1-like protein 2 (ORMDL2)

This Recombinant Human ORM1-like protein 2 (ORMDL2) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 2, Adoplin-2

UniProt

Q53FV1

Expression Region

1-153

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLAT YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRVFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERVV-2 Protein Lysate
MBS8411228-01 0.02 mg

Human ERVV-2 Protein Lysate

Sign In for Pricing
View Details
Human ERVV-2 Protein Lysate
MBS8411228-02 5x 0.02 mg

Human ERVV-2 Protein Lysate

Sign In for Pricing
View Details
Lentiviral human PPM1A shRNA (UAS) - Lentiviral human PPM1A shRNA (UAS) (25)
GTR15341936 1 Vial

Lentiviral human PPM1A shRNA (UAS) - Lentiviral human PPM1A shRNA (UAS) (25)

Sign In for Pricing
View Details
Sulfo-Cy5 picolyl azide
T206069-01 10 mg

Sulfo-Cy5 picolyl azide

Sign In for Pricing
View Details
Sulfo-Cy5 picolyl azide
T206069-02 50 mg

Sulfo-Cy5 picolyl azide

Sign In for Pricing
View Details
TMEM129 Protein Vector (Mouse) (pPB-N-His)
PV239035 500 ng

TMEM129 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details