Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis ORM1-like protein 1 (ormdl1)

This Recombinant Xenopus laevis ORM1-like protein 1 (ormdl1) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 1

UniProt

Q5XH57

Expression Region

1-153

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGMLHIVLLSIPFFSVPVAWTLTNVIHNLGM YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFLTISPIILYFLASFYTKYD PTHFFINTASLLSVLIPKLPQLHGVRIFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMB2 Antibody - Biotin Conjugated
OACA01958-100UG 100 µg

LAMB2 Antibody - Biotin Conjugated

Sign In for Pricing
View Details
Human TMEM62 Protein Lysate
MBS8428820-01 0.02 mg

Human TMEM62 Protein Lysate

Sign In for Pricing
View Details
Human TMEM62 Protein Lysate
MBS8428820-02 5x 0.02 mg

Human TMEM62 Protein Lysate

Sign In for Pricing
View Details
Complement C3 (aa681-693) Immunizing Peptide
orb66434 100 µg

Complement C3 (aa681-693) Immunizing Peptide

Sign In for Pricing
View Details
PRKD2 Adenovirus (Human)
37649051 1.0 mL

PRKD2 Adenovirus (Human)

Sign In for Pricing
View Details
SYNGR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2321108 1.0 µg DNA

SYNGR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details