Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken ORM1-like protein 2 (ORMDL2)

This Recombinant Chicken ORM1-like protein 2 (ORMDL2) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 2

UniProt

Q5ZIU0

Expression Region

1-153

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGVAHSEVNPNTRVMSSRGIWLAYVISVAALHVILLSIPFFSIPVVWTLTNVIHNLVM YLLLHTVKGTPFETPDQGKDRLLTHWEQIDYGMQCTSSRKFLSISPVVLYLLTSFYIKYD PAHFMINTASLLSVLLPKLPQFHGVRVFGINKY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT1, CT (GOT1, Aspartate aminotransferase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A) (FITC)
MBS6303318-01 0.2 mL

GOT1, CT (GOT1, Aspartate aminotransferase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A) (FITC)

Sign In for Pricing
View Details
GOT1, CT (GOT1, Aspartate aminotransferase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A) (FITC)
MBS6303318-02 5x 0.2 mL

GOT1, CT (GOT1, Aspartate aminotransferase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A) (FITC)

Sign In for Pricing
View Details
Hugl-1 CRISPR Activation Plasmid (h2)
sc-403441-ACT-2 20 µg

Hugl-1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Tide Fluor™ 1 CPG [TF1 CPG] *500 Å* *Superior replacement for EDANS*
2240-AAT 100 mg

Tide Fluor™ 1 CPG [TF1 CPG] *500 Å* *Superior replacement for EDANS*

Sign In for Pricing
View Details
Anti-Chapsyn-110 MAGUK Antibody FL550 Conjugate
75-284-FL550 200 µL

Anti-Chapsyn-110 MAGUK Antibody FL550 Conjugate

Sign In for Pricing
View Details
Ugt2b36 AAV siRNA Pooled Vector
49141166 1.0 µg

Ugt2b36 AAV siRNA Pooled Vector

Sign In for Pricing
View Details