Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b' (atpG)
This Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
Q7V034
Expression Region
1-153
Origin
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLAFDFFGATEGGLFDINATLPLMAIQVVALTYILNSLFFKPVGNVVEKREKFVSNNIMD AKNKLSEVEKLEADLLSQLQSARYEAQKIVSEAENESDKLYKEALALANDEANASKEKAR LEIENQTSSARDQLFKQADDLSELIVNRLILEK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
132607-ML650 100 µL
MEX3B (RNA-binding Protein MEX3B, MEX-3B, KIAA2009, RING Finger and KH Domain-containing Protein 3, RKHD3, RING Finger Protein 195, RNF195) (MaxLight 650)
Sign In for Pricing
View Details 
orb1375274 20 µg
FGFR1 Oncogene Partner (FGFR1OP) Human Over-expression Lysate
Sign In for Pricing
View Details