Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)

This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q7VA60

Expression Region

1-153

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLLLFGASEGGLFDFDATLPLMAAQVVLLTFILNALFFKPVGRVVEDREDYVLTSRAE AKKKLAEVEKLENDLKNQLKEARKAAQQVISEAEEDSEKLYKEALNLANSEANASREQAR REIDSQRDSALKKLKSDSDKLGDLIVERLLAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luria Bertani Agar, Miller
DM 2151-01 2.5 Kg

Luria Bertani Agar, Miller

Sign In for Pricing
View Details
Luria Bertani Agar, Miller
DM 2151-02 100 g

Luria Bertani Agar, Miller

Sign In for Pricing
View Details
Luria Bertani Agar, Miller
DM 2151-03 500 g

Luria Bertani Agar, Miller

Sign In for Pricing
View Details
Luria Bertani Agar, Miller
DM 2151-04 1 kg

Luria Bertani Agar, Miller

Sign In for Pricing
View Details
Luria Bertani Agar, Miller
DM 2151-05 1 Kg

Luria Bertani Agar, Miller

Sign In for Pricing
View Details
Methyl 3- (methylamino) butanoate
OR1033494-01 100 mg

Methyl 3- (methylamino) butanoate

Sign In for Pricing
View Details