Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG)
This Recombinant Prochlorococcus marinus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
Q7VA60
Expression Region
1-153
Origin
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTSLLLFGASEGGLFDFDATLPLMAAQVVLLTFILNALFFKPVGRVVEDREDYVLTSRAE AKKKLAEVEKLENDLKNQLKEARKAAQQVISEAEEDSEKLYKEALNLANSEANASREQAR REIDSQRDSALKKLKSDSDKLGDLIVERLLAAK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10399126 96 Well
Canine Armadillo repeat containing X linked protein 4 (ARMCX4) ELISA kit
Sign In for Pricing
View Details 28593066 1.0 µg DNA
MIER1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details