Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse ORM1-like protein 1 (Ormdl1)

This Recombinant Mouse ORM1-like protein 1 (Ormdl1) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 1

UniProt

Q921I0

Expression Region

1-153

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGM YVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSDL2, ID (HSDL2, C9orf99, Hydroxysteroid dehydrogenase-like protein 2) (AP) discontinued
036788-AP 200 µL

HSDL2, ID (HSDL2, C9orf99, Hydroxysteroid dehydrogenase-like protein 2) (AP) discontinued

Sign In for Pricing
View Details
Animal Cell
4080100 1 Each

Animal Cell

Sign In for Pricing
View Details
DUSP26 Rabbit Polyclonal Antibody (Cy5)
orb882218 100 µL

DUSP26 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
D17H6S53E ORF Vector (Mouse) (pORF)
ORF042514 1.0 µg DNA

D17H6S53E ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
DUX3 Rabbit Polyclonal Antibody
orb3068453-01 30 µL

DUX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DUX3 Rabbit Polyclonal Antibody
orb3068453-02 50 µL

DUX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details