Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ORM1-like protein 1 (ORMDL1)

This Recombinant Human ORM1-like protein 1 (ORMDL1) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 1, Adoplin-1

UniProt

Q9P0S3

Expression Region

1-153

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKIa (Protein Kinase Inhibitor α) Sheep ELISA Kit
F9128 96 Tests

PKIa (Protein Kinase Inhibitor α) Sheep ELISA Kit

Sign In for Pricing
View Details
NTF4 Protein Vector (Rat) (pPM-C-His)
PV286241 500 ng

NTF4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Interleukin 2 (IL-2) (APC) discontinued
I7663-32C-APC 100 µL

Interleukin 2 (IL-2) (APC) discontinued

Sign In for Pricing
View Details
PPCS Antibody
orb423763-01 5 µg

PPCS Antibody

Sign In for Pricing
View Details
PPCS Antibody
orb423763-02 20 µg

PPCS Antibody

Sign In for Pricing
View Details
PPCS Antibody
orb423763-03 100 µg

PPCS Antibody

Sign In for Pricing
View Details