Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse ORM1-like protein 2 (Ormdl2)

This Recombinant Mouse ORM1-like protein 2 (Ormdl2) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 2

UniProt

Q9CQZ0

Expression Region

1-153

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRLFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Nuclear TF Y subunit alpha Recombinant Protein N-GST Tag Lyophilized 50UG
IHUNTFYSARNGSTLY50UG 50 µg

Human Nuclear TF Y subunit alpha Recombinant Protein N-GST Tag Lyophilized 50UG

Sign In for Pricing
View Details
Anti-Cytokeratin 18 (CK18) Monoclonal Antibody
MBS2170426-01 25 Tests

Anti-Cytokeratin 18 (CK18) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 18 (CK18) Monoclonal Antibody
MBS2170426-02 50 Tests

Anti-Cytokeratin 18 (CK18) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 18 (CK18) Monoclonal Antibody
MBS2170426-03 100 Tests

Anti-Cytokeratin 18 (CK18) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 18 (CK18) Monoclonal Antibody
MBS2170426-04 200 Tests

Anti-Cytokeratin 18 (CK18) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 18 (CK18) Monoclonal Antibody
MBS2170426-05 500 Tests

Anti-Cytokeratin 18 (CK18) Monoclonal Antibody

Sign In for Pricing
View Details