Recombinant Mouse ORM1-like protein 2 (Ormdl2)
This Recombinant Mouse ORM1-like protein 2 (Ormdl2) spans the amino acid sequence from region 1-153.
Product Specifications
Product Name Alternative
ORM1-like protein 2
UniProt
Q9CQZ0
Expression Region
1-153
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRLFGINKY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15251883 1 Vial
Lentiviral mouse Glt28d2 shRNA (UAS) - Lentiviral mouse Glt28d2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
D9901-65A-AP 100 µL
DYNLT3 (Dynein light chain Tctex-type 3, RCG42244, isoform CRA_a, Tcte1l) (AP) discontinued
Sign In for Pricing
View Details 
MBS6189616-01 0.1 mL
CRLF2 (Cytokine Receptor-like Factor 2, Cytokine Receptor-like 2, IL-XR, Thymic Stromal Lymphopoietin Protein Receptor, TSLP Receptor, CRL2, ILXR, TSLPR) (MaxLight 405)
Sign In for Pricing
View Details