Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P25761

Expression Region

1-153

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL LIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILISGDPHIPFRAVSTTDPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Neuropeptide Y (NPY) Monoclonal antibody
FY-AB36128-01 1 mL

Anti-Neuropeptide Y (NPY) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Neuropeptide Y (NPY) Monoclonal antibody
FY-AB36128-02 100 µL

Anti-Neuropeptide Y (NPY) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Neuropeptide Y (NPY) Monoclonal antibody
FY-AB36128-03 200 µL

Anti-Neuropeptide Y (NPY) Monoclonal antibody

Sign In for Pricing
View Details
ITGB7 Antibody
E30AOC597 100 µL

ITGB7 Antibody

Sign In for Pricing
View Details
BANK1 Rabbit pAb (APR17936N)
APR17936N-01 50 µL

BANK1 Rabbit pAb (APR17936N)

Sign In for Pricing
View Details
BANK1 Rabbit pAb (APR17936N)
APR17936N-02 100 µL

BANK1 Rabbit pAb (APR17936N)

Sign In for Pricing
View Details